PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g20130.1.p
Common NameBRADI_5g20130, LOC100832103
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 366aa    MW: 39380.2 Da    PI: 4.8608
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g20130.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61e-161663148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd +l+ +++++G  +W++ ++  g+ R++k+c++rw +yl
  Bradi5g20130.1.p 16 KGSWTPEEDMRLIAYIQKYGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                      799*****************************99************97 PP

2Myb_DNA-binding57.43.3e-1869114148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T+eE+e l++++++lG++ W++Ia++++ gRt++++k+ w+++l
  Bradi5g20130.1.p  69 RGNFTAEEEETLIKLHAMLGNK-WSKIAACLP-GRTDNEIKNVWNTHL 114
                       89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-24766IPR009057Homeodomain-like
PROSITE profilePS5129415.1951163IPR017930Myb domain
SuperFamilySSF466891.12E-3013110IPR009057Homeodomain-like
SMARTSM007172.3E-131565IPR001005SANT/Myb domain
PfamPF002492.8E-151663IPR001005SANT/Myb domain
CDDcd001671.24E-101863No hitNo description
PROSITE profilePS5129425.66364118IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-2767118IPR009057Homeodomain-like
SMARTSM007174.3E-1668116IPR001005SANT/Myb domain
PfamPF002491.9E-1669114IPR001005SANT/Myb domain
CDDcd001674.75E-1271114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MGKGRAPCCA KVGLNKGSWT PEEDMRLIAY IQKYGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTAEEEETL IKLHAMLGNK WSKIAACLPG RTDNEIKNVW NTHLKKRVAA  120
ASGGEKKNKK NTKNNKESGA KRQKKPDLPP APSPSQSSST TTTTTTTNCS SGDSAGEQQS  180
NTSKETDALD NIMEIPTLDA LGFDFDMLVQ DTDPVPAQTS YCVPPPAAAA SPCSSASPPC  240
AADGELLDLP ELDIVPELWS IIDGDAEAPW SNAAAACHVE AGEDGKEWWL EDLERELGLW  300
GPMEDYQCIN PGPQAQSGRV DPLSVSAGVE LDPVSCYFQA GPAVATSALQ GSEHSAVLTD  360
NRMDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-281411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0701451e-158BT070145.1 Zea mays full-length cDNA clone ZM_BFc0138F01 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580443.10.0PREDICTED: myb-related protein Zm1-like
SwissprotP200241e-104MYB1_MAIZE; Myb-related protein Zm1
TrEMBLI1J1860.0I1J186_BRADI; Uncharacterized protein
STRINGBRADI5G20130.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.11e-71myb domain protein 63